Skip to main content

Table 1 Amino acid sequence of target regions

From: An In Vivo Targeted Deletion of the Calmodulin-Binding Domain from Rice Glutamate Decarboxylase 3 (OsGAD3) Increases γ-Aminobutyric Acid Content in Grains

ClassAmino acid sequence
NiPPAPLLVVAKKSELETQRSVTEAWKKFVLAKRTNGVC
1PPAPLLVVAKSRSSRRSGR
2PPAPLLVVAKSRSSRRSGR
3PPAPLLVVAKNRSSRRSGR
4PPAPLLVVAKKVGARDAAVGDGGVEEVRARQEDQRRLLVSISDSATAYKSTNQDAAD
5PPAPLLVVAKRVGARDAAVGDGGVEEVRARQEDQRRLLVSISDSATAYKSTNQDAAD
6PPAPLLVGDGGVEEVRARQEDQRRLLVSISDSATAYKSTNQDAAD
7PQRSVTEAWKKFVLAKRTNGVC
8PPAPLLVVAKNQDAAD